SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V1SW06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V1SW06
Domain Number 1 Region: 93-162
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.57e-28
Family Cyanase C-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000162
Family SinR domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V1SW06
Sequence length 162
Comment (tr|A0A1V1SW06|A0A1V1SW06_9FUNG) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_03139} KW=Complete proteome; Reference proteome OX=1813822 OS=fungal sp. No.14919. GN=ANO14919_020620 OC=Eukaryota; Fungi.
Sequence
MADRVATLDSSLADKLPAYSKVLFEAKANQKLSFEAIAKELGRGEVAVAALFYGQAQASP
EDVEKLSNLLGVPKGALEASMGGFPDRGRAGPMPPVEPLIYRLYEVVQNYGYAFKAILNE
KFGDGIMSAIAFSSKVEKEVDSDGVTWANITLRGKWLPYSRF
Download sequence
Identical sequences A0A1V1SW06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]