SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V3CGA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1V3CGA6
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0471
Family Capz alpha-1 subunit 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V3CGA6
Sequence length 76
Comment (tr|A0A1V3CGA6|A0A1V3CGA6_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:OOC78228.1} KW=Complete proteome OX=562 OS=Escherichia coli. GN=BTQ04_21135 OC=Enterobacteriaceae; Escherichia.
Sequence
MIYMGLWLKIFKIVVGENENYLKDVMMQLEAKNNEGKYVISKANGNPVFKELFWKAIDEF
NFPQEELNRLKQYRSL
Download sequence
Identical sequences A0A0F6CB24 A0A0H3JLN9 A0A1V3CGA6 A0A1Z3UXD4
gi|387884938|ref|YP_006315240.1| gi|15833896|ref|NP_312669.1| NP_312669.1.58667 WP_001456706.1.10001 WP_001456706.1.100073 WP_001456706.1.10010 WP_001456706.1.100299 WP_001456706.1.100302 WP_001456706.1.100508 WP_001456706.1.100554 WP_001456706.1.100925 WP_001456706.1.101105 WP_001456706.1.101166 WP_001456706.1.101206 WP_001456706.1.101628 WP_001456706.1.10206 WP_001456706.1.102094 WP_001456706.1.102139 WP_001456706.1.10273 WP_001456706.1.10335 WP_001456706.1.10476 WP_001456706.1.10761 WP_001456706.1.10970 WP_001456706.1.1111 WP_001456706.1.11240 WP_001456706.1.11301 WP_001456706.1.11420 WP_001456706.1.11671 WP_001456706.1.11690 WP_001456706.1.12259 WP_001456706.1.12305 WP_001456706.1.12552 WP_001456706.1.13060 WP_001456706.1.13217 WP_001456706.1.13223 WP_001456706.1.13332 WP_001456706.1.13348 WP_001456706.1.13430 WP_001456706.1.13442 WP_001456706.1.13481 WP_001456706.1.13881 WP_001456706.1.13936 WP_001456706.1.13939 WP_001456706.1.14110 WP_001456706.1.14453 WP_001456706.1.14621 WP_001456706.1.14748 WP_001456706.1.15356 WP_001456706.1.15503 WP_001456706.1.15527 WP_001456706.1.1559 WP_001456706.1.15626 WP_001456706.1.15702 WP_001456706.1.15782 WP_001456706.1.16075 WP_001456706.1.16133 WP_001456706.1.16222 WP_001456706.1.16272 WP_001456706.1.16463 WP_001456706.1.16481 WP_001456706.1.16845 WP_001456706.1.17187 WP_001456706.1.1731 WP_001456706.1.17386 WP_001456706.1.17415 WP_001456706.1.17515 WP_001456706.1.17904 WP_001456706.1.18136 WP_001456706.1.18326 WP_001456706.1.1834 WP_001456706.1.18340 WP_001456706.1.1881 WP_001456706.1.18837 WP_001456706.1.18995 WP_001456706.1.19039 WP_001456706.1.191 WP_001456706.1.19140 WP_001456706.1.19350 WP_001456706.1.19840 WP_001456706.1.19847 WP_001456706.1.2005 WP_001456706.1.20449 WP_001456706.1.20480 WP_001456706.1.20546 WP_001456706.1.20594 WP_001456706.1.20745 WP_001456706.1.20893 WP_001456706.1.20941 WP_001456706.1.20950 WP_001456706.1.20989 WP_001456706.1.21508 WP_001456706.1.21666 WP_001456706.1.21668 WP_001456706.1.21962 WP_001456706.1.2218 WP_001456706.1.22251 WP_001456706.1.22304 WP_001456706.1.22381 WP_001456706.1.22594 WP_001456706.1.22743 WP_001456706.1.22925 WP_001456706.1.23073 WP_001456706.1.23115 WP_001456706.1.23241 WP_001456706.1.23323 WP_001456706.1.23355 WP_001456706.1.23467 WP_001456706.1.23790 WP_001456706.1.23806 WP_001456706.1.23838 WP_001456706.1.2388 WP_001456706.1.23895 WP_001456706.1.23899 WP_001456706.1.23973 WP_001456706.1.23984 WP_001456706.1.24070 WP_001456706.1.24283 WP_001456706.1.24341 WP_001456706.1.24753 WP_001456706.1.24870 WP_001456706.1.25076 WP_001456706.1.25082 WP_001456706.1.25088 WP_001456706.1.25201 WP_001456706.1.25305 WP_001456706.1.25526 WP_001456706.1.25577 WP_001456706.1.25794 WP_001456706.1.25819 WP_001456706.1.25831 WP_001456706.1.26066 WP_001456706.1.26105 WP_001456706.1.26121 WP_001456706.1.26134 WP_001456706.1.26246 WP_001456706.1.26474 WP_001456706.1.26525 WP_001456706.1.26590 WP_001456706.1.26761 WP_001456706.1.26878 WP_001456706.1.26975 WP_001456706.1.26998 WP_001456706.1.27338 WP_001456706.1.27445 WP_001456706.1.28143 WP_001456706.1.28551 WP_001456706.1.28734 WP_001456706.1.28879 WP_001456706.1.291 WP_001456706.1.29126 WP_001456706.1.29404 WP_001456706.1.29564 WP_001456706.1.29597 WP_001456706.1.29618 WP_001456706.1.2978 WP_001456706.1.29818 WP_001456706.1.29976 WP_001456706.1.30 WP_001456706.1.30019 WP_001456706.1.30052 WP_001456706.1.30064 WP_001456706.1.30164 WP_001456706.1.30476 WP_001456706.1.30637 WP_001456706.1.30918 WP_001456706.1.30993 WP_001456706.1.30999 WP_001456706.1.31055 WP_001456706.1.312 WP_001456706.1.31252 WP_001456706.1.3140 WP_001456706.1.31401 WP_001456706.1.31575 WP_001456706.1.31715 WP_001456706.1.31956 WP_001456706.1.32063 WP_001456706.1.322 WP_001456706.1.32243 WP_001456706.1.32536 WP_001456706.1.32574 WP_001456706.1.32590 WP_001456706.1.32888 WP_001456706.1.32931 WP_001456706.1.3295 WP_001456706.1.33049 WP_001456706.1.33055 WP_001456706.1.33094 WP_001456706.1.33125 WP_001456706.1.33146 WP_001456706.1.33167 WP_001456706.1.33178 WP_001456706.1.33268 WP_001456706.1.33981 WP_001456706.1.34269 WP_001456706.1.34383 WP_001456706.1.34500 WP_001456706.1.34680 WP_001456706.1.34686 WP_001456706.1.35393 WP_001456706.1.3550 WP_001456706.1.36010 WP_001456706.1.36212 WP_001456706.1.36626 WP_001456706.1.36767 WP_001456706.1.37102 WP_001456706.1.37337 WP_001456706.1.37372 WP_001456706.1.3762 WP_001456706.1.37731 WP_001456706.1.37766 WP_001456706.1.37769 WP_001456706.1.3795 WP_001456706.1.38050 WP_001456706.1.38063 WP_001456706.1.38107 WP_001456706.1.38306 WP_001456706.1.38369 WP_001456706.1.389 WP_001456706.1.38958 WP_001456706.1.39180 WP_001456706.1.39268 WP_001456706.1.39310 WP_001456706.1.39415 WP_001456706.1.39564 WP_001456706.1.39601 WP_001456706.1.39646 WP_001456706.1.39820 WP_001456706.1.40113 WP_001456706.1.40234 WP_001456706.1.4030 WP_001456706.1.40549 WP_001456706.1.40629 WP_001456706.1.40742 WP_001456706.1.40758 WP_001456706.1.40793 WP_001456706.1.40882 WP_001456706.1.40900 WP_001456706.1.40952 WP_001456706.1.4103 WP_001456706.1.41060 WP_001456706.1.41294 WP_001456706.1.41330 WP_001456706.1.41478 WP_001456706.1.41536 WP_001456706.1.41734 WP_001456706.1.41849 WP_001456706.1.42036 WP_001456706.1.4213 WP_001456706.1.42447 WP_001456706.1.4250 WP_001456706.1.42513 WP_001456706.1.42594 WP_001456706.1.4261 WP_001456706.1.42863 WP_001456706.1.42975 WP_001456706.1.43013 WP_001456706.1.43079 WP_001456706.1.43121 WP_001456706.1.4313 WP_001456706.1.43140 WP_001456706.1.43196 WP_001456706.1.43384 WP_001456706.1.43448 WP_001456706.1.43469 WP_001456706.1.43536 WP_001456706.1.43604 WP_001456706.1.43754 WP_001456706.1.43798 WP_001456706.1.43816 WP_001456706.1.43837 WP_001456706.1.43911 WP_001456706.1.43939 WP_001456706.1.44125 WP_001456706.1.44165 WP_001456706.1.44389 WP_001456706.1.44488 WP_001456706.1.44561 WP_001456706.1.44733 WP_001456706.1.44906 WP_001456706.1.44954 WP_001456706.1.45020 WP_001456706.1.45076 WP_001456706.1.45153 WP_001456706.1.45195 WP_001456706.1.45293 WP_001456706.1.45575 WP_001456706.1.45707 WP_001456706.1.45841 WP_001456706.1.45901 WP_001456706.1.45941 WP_001456706.1.46039 WP_001456706.1.4619 WP_001456706.1.46282 WP_001456706.1.46283 WP_001456706.1.46369 WP_001456706.1.46414 WP_001456706.1.46451 WP_001456706.1.46503 WP_001456706.1.46597 WP_001456706.1.46611 WP_001456706.1.46626 WP_001456706.1.46810 WP_001456706.1.46832 WP_001456706.1.46913 WP_001456706.1.4708 WP_001456706.1.47140 WP_001456706.1.4723 WP_001456706.1.47411 WP_001456706.1.47784 WP_001456706.1.47827 WP_001456706.1.47884 WP_001456706.1.47954 WP_001456706.1.47994 WP_001456706.1.48065 WP_001456706.1.4812 WP_001456706.1.48176 WP_001456706.1.48226 WP_001456706.1.48258 WP_001456706.1.48697 WP_001456706.1.48712 WP_001456706.1.48792 WP_001456706.1.48806 WP_001456706.1.4931 WP_001456706.1.49332 WP_001456706.1.49401 WP_001456706.1.49464 WP_001456706.1.49496 WP_001456706.1.49567 WP_001456706.1.49655 WP_001456706.1.49771 WP_001456706.1.5003 WP_001456706.1.50110 WP_001456706.1.50345 WP_001456706.1.50358 WP_001456706.1.5037 WP_001456706.1.50380 WP_001456706.1.50549 WP_001456706.1.50762 WP_001456706.1.50986 WP_001456706.1.51154 WP_001456706.1.51171 WP_001456706.1.51505 WP_001456706.1.51643 WP_001456706.1.51693 WP_001456706.1.51834 WP_001456706.1.52039 WP_001456706.1.5217 WP_001456706.1.52496 WP_001456706.1.52543 WP_001456706.1.52883 WP_001456706.1.52933 WP_001456706.1.53084 WP_001456706.1.53181 WP_001456706.1.53211 WP_001456706.1.53252 WP_001456706.1.53270 WP_001456706.1.54024 WP_001456706.1.54213 WP_001456706.1.5441 WP_001456706.1.54454 WP_001456706.1.5467 WP_001456706.1.54883 WP_001456706.1.55218 WP_001456706.1.55820 WP_001456706.1.55838 WP_001456706.1.55892 WP_001456706.1.55897 WP_001456706.1.56072 WP_001456706.1.56151 WP_001456706.1.5639 WP_001456706.1.56392 WP_001456706.1.56481 WP_001456706.1.56489 WP_001456706.1.56491 WP_001456706.1.56554 WP_001456706.1.56571 WP_001456706.1.57032 WP_001456706.1.57071 WP_001456706.1.57180 WP_001456706.1.57197 WP_001456706.1.57280 WP_001456706.1.57453 WP_001456706.1.57466 WP_001456706.1.57610 WP_001456706.1.5764 WP_001456706.1.57646 WP_001456706.1.57836 WP_001456706.1.58048 WP_001456706.1.58057 WP_001456706.1.58169 WP_001456706.1.58238 WP_001456706.1.584 WP_001456706.1.58423 WP_001456706.1.5852 WP_001456706.1.58707 WP_001456706.1.58723 WP_001456706.1.59038 WP_001456706.1.59359 WP_001456706.1.59374 WP_001456706.1.59470 WP_001456706.1.59491 WP_001456706.1.59679 WP_001456706.1.59733 WP_001456706.1.59838 WP_001456706.1.59905 WP_001456706.1.59931 WP_001456706.1.59959 WP_001456706.1.60042 WP_001456706.1.60043 WP_001456706.1.60117 WP_001456706.1.6013 WP_001456706.1.60304 WP_001456706.1.60374 WP_001456706.1.60461 WP_001456706.1.60613 WP_001456706.1.60647 WP_001456706.1.60744 WP_001456706.1.60761 WP_001456706.1.60872 WP_001456706.1.61039 WP_001456706.1.61099 WP_001456706.1.61108 WP_001456706.1.61186 WP_001456706.1.61253 WP_001456706.1.61623 WP_001456706.1.618 WP_001456706.1.61874 WP_001456706.1.62135 WP_001456706.1.62182 WP_001456706.1.62480 WP_001456706.1.6261 WP_001456706.1.62675 WP_001456706.1.62843 WP_001456706.1.62888 WP_001456706.1.6331 WP_001456706.1.63445 WP_001456706.1.63563 WP_001456706.1.63586 WP_001456706.1.63615 WP_001456706.1.6364 WP_001456706.1.63872 WP_001456706.1.63957 WP_001456706.1.64086 WP_001456706.1.64161 WP_001456706.1.64371 WP_001456706.1.6445 WP_001456706.1.64621 WP_001456706.1.64946 WP_001456706.1.65035 WP_001456706.1.65084 WP_001456706.1.65118 WP_001456706.1.65194 WP_001456706.1.65372 WP_001456706.1.65546 WP_001456706.1.6587 WP_001456706.1.65875 WP_001456706.1.65898 WP_001456706.1.65963 WP_001456706.1.65978 WP_001456706.1.65988 WP_001456706.1.66033 WP_001456706.1.66100 WP_001456706.1.66531 WP_001456706.1.66566 WP_001456706.1.66873 WP_001456706.1.66922 WP_001456706.1.67073 WP_001456706.1.67136 WP_001456706.1.67150 WP_001456706.1.67214 WP_001456706.1.67446 WP_001456706.1.67533 WP_001456706.1.67676 WP_001456706.1.6769 WP_001456706.1.67726 WP_001456706.1.67753 WP_001456706.1.67775 WP_001456706.1.67780 WP_001456706.1.68096 WP_001456706.1.68411 WP_001456706.1.68493 WP_001456706.1.68523 WP_001456706.1.6880 WP_001456706.1.6887 WP_001456706.1.68936 WP_001456706.1.69054 WP_001456706.1.69350 WP_001456706.1.69351 WP_001456706.1.69780 WP_001456706.1.69810 WP_001456706.1.69818 WP_001456706.1.69896 WP_001456706.1.70123 WP_001456706.1.70125 WP_001456706.1.70517 WP_001456706.1.70539 WP_001456706.1.70576 WP_001456706.1.70713 WP_001456706.1.70723 WP_001456706.1.70787 WP_001456706.1.71003 WP_001456706.1.71099 WP_001456706.1.71205 WP_001456706.1.71225 WP_001456706.1.71226 WP_001456706.1.71269 WP_001456706.1.71423 WP_001456706.1.71448 WP_001456706.1.71840 WP_001456706.1.71940 WP_001456706.1.72016 WP_001456706.1.72180 WP_001456706.1.72322 WP_001456706.1.72427 WP_001456706.1.72614 WP_001456706.1.72641 WP_001456706.1.72694 WP_001456706.1.7291 WP_001456706.1.72913 WP_001456706.1.73126 WP_001456706.1.73343 WP_001456706.1.73626 WP_001456706.1.73785 WP_001456706.1.73801 WP_001456706.1.7392 WP_001456706.1.73934 WP_001456706.1.73968 WP_001456706.1.7429 WP_001456706.1.7446 WP_001456706.1.74521 WP_001456706.1.74536 WP_001456706.1.74557 WP_001456706.1.74828 WP_001456706.1.74904 WP_001456706.1.75030 WP_001456706.1.75164 WP_001456706.1.75248 WP_001456706.1.75382 WP_001456706.1.7539 WP_001456706.1.75507 WP_001456706.1.75536 WP_001456706.1.75577 WP_001456706.1.75694 WP_001456706.1.75767 WP_001456706.1.7583 WP_001456706.1.75989 WP_001456706.1.76054 WP_001456706.1.7608 WP_001456706.1.76152 WP_001456706.1.76189 WP_001456706.1.76407 WP_001456706.1.76477 WP_001456706.1.76697 WP_001456706.1.76827 WP_001456706.1.77099 WP_001456706.1.77128 WP_001456706.1.77239 WP_001456706.1.77275 WP_001456706.1.77392 WP_001456706.1.77644 WP_001456706.1.77707 WP_001456706.1.77760 WP_001456706.1.77961 WP_001456706.1.77979 WP_001456706.1.7799 WP_001456706.1.78063 WP_001456706.1.784 WP_001456706.1.7855 WP_001456706.1.78593 WP_001456706.1.78611 WP_001456706.1.79172 WP_001456706.1.7940 WP_001456706.1.79528 WP_001456706.1.79563 WP_001456706.1.79576 WP_001456706.1.79715 WP_001456706.1.79965 WP_001456706.1.80309 WP_001456706.1.80330 WP_001456706.1.80578 WP_001456706.1.80606 WP_001456706.1.81070 WP_001456706.1.81160 WP_001456706.1.81273 WP_001456706.1.81420 WP_001456706.1.81442 WP_001456706.1.81514 WP_001456706.1.81754 WP_001456706.1.81821 WP_001456706.1.81873 WP_001456706.1.81934 WP_001456706.1.81975 WP_001456706.1.82010 WP_001456706.1.82057 WP_001456706.1.82296 WP_001456706.1.82594 WP_001456706.1.82629 WP_001456706.1.8268 WP_001456706.1.82797 WP_001456706.1.82820 WP_001456706.1.83099 WP_001456706.1.83712 WP_001456706.1.84219 WP_001456706.1.84264 WP_001456706.1.84312 WP_001456706.1.84482 WP_001456706.1.84635 WP_001456706.1.84657 WP_001456706.1.8477 WP_001456706.1.85253 WP_001456706.1.85558 WP_001456706.1.85722 WP_001456706.1.85772 WP_001456706.1.86171 WP_001456706.1.86225 WP_001456706.1.86255 WP_001456706.1.86340 WP_001456706.1.86574 WP_001456706.1.86994 WP_001456706.1.87076 WP_001456706.1.87247 WP_001456706.1.87254 WP_001456706.1.87382 WP_001456706.1.87616 WP_001456706.1.88197 WP_001456706.1.8843 WP_001456706.1.88524 WP_001456706.1.88528 WP_001456706.1.88803 WP_001456706.1.88891 WP_001456706.1.89322 WP_001456706.1.89385 WP_001456706.1.89405 WP_001456706.1.89569 WP_001456706.1.89781 WP_001456706.1.89959 WP_001456706.1.89988 WP_001456706.1.90139 WP_001456706.1.90219 WP_001456706.1.90257 WP_001456706.1.90342 WP_001456706.1.90349 WP_001456706.1.90837 WP_001456706.1.90848 WP_001456706.1.90967 WP_001456706.1.9098 WP_001456706.1.90997 WP_001456706.1.91072 WP_001456706.1.91088 WP_001456706.1.91153 WP_001456706.1.91288 WP_001456706.1.91356 WP_001456706.1.91384 WP_001456706.1.91548 WP_001456706.1.91651 WP_001456706.1.9168 WP_001456706.1.91801 WP_001456706.1.91871 WP_001456706.1.92819 WP_001456706.1.93027 WP_001456706.1.93069 WP_001456706.1.93427 WP_001456706.1.93428 WP_001456706.1.93601 WP_001456706.1.93630 WP_001456706.1.93670 WP_001456706.1.93695 WP_001456706.1.93821 WP_001456706.1.94213 WP_001456706.1.9426 WP_001456706.1.94302 WP_001456706.1.94343 WP_001456706.1.94544 WP_001456706.1.94589 WP_001456706.1.94676 WP_001456706.1.94790 WP_001456706.1.94991 WP_001456706.1.95011 WP_001456706.1.95028 WP_001456706.1.95035 WP_001456706.1.95129 WP_001456706.1.95834 WP_001456706.1.9616 WP_001456706.1.96425 WP_001456706.1.96450 WP_001456706.1.96725 WP_001456706.1.96796 WP_001456706.1.97193 WP_001456706.1.9729 WP_001456706.1.9740 WP_001456706.1.97402 WP_001456706.1.97513 WP_001456706.1.97632 WP_001456706.1.9770 WP_001456706.1.97789 WP_001456706.1.97871 WP_001456706.1.98046 WP_001456706.1.98083 WP_001456706.1.981 WP_001456706.1.98155 WP_001456706.1.98176 WP_001456706.1.98187 WP_001456706.1.98205 WP_001456706.1.98279 WP_001456706.1.98312 WP_001456706.1.98384 WP_001456706.1.98543 WP_001456706.1.98569 WP_001456706.1.9883 WP_001456706.1.98920 WP_001456706.1.99101 WP_001456706.1.99234 WP_001456706.1.99487 WP_001456706.1.99501 WP_001456706.1.99692 WP_001456706.1.99986 386585.ECs4642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]