SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V5A9V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V5A9V5
Domain Number 1 Region: 8-75
Classification Level Classification E-value
Superfamily AF1782-like 0.00000000000000262
Family AF1782-like 0.0041
Further Details:      
 
Domain Number 2 Region: 97-179
Classification Level Classification E-value
Superfamily AF1782-like 0.0000000000126
Family AF1782-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V5A9V5
Sequence length 188
Comment (tr|A0A1V5A9V5|A0A1V5A9V5_9EURY) Uncharacterized protein {ECO:0000313|EMBL:OPY43083.1} OX=1811726 OS=Methanoregulaceae archaeon PtaU1.Bin222. GN=A4E42_01431 OC=Methanoregulaceae.
Sequence
MQHWKCELESRLQDLVISVPPSSILDHLADDLSGMARSYLSDGDHFLSSGDPVNALASWA
YALGWIDAGASLGVFTTRVRDPGWVFSHIHPFPGFESFLREKTARYHALLHSAIQSVVPS
PEPDTVMHDAAARFLAASVVSREYGRYFCTLGRLDNALGSFSYGHAWLDSGVRAGLFRVA
GKREIFTL
Download sequence
Identical sequences A0A1V5A9V5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]