SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V5KKM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V5KKM7
Domain Number 1 Region: 42-268
Classification Level Classification E-value
Superfamily Dipeptide transport protein 4.18e-49
Family Dipeptide transport protein 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V5KKM7
Sequence length 294
Comment (tr|A0A1V5KKM7|A0A1V5KKM7_9BACT) D-aminopeptidase {ECO:0000313|EMBL:OPZ69156.1} OX=1866932 OS=bacterium ADurb.Bin478. GN=BWY83_02074 OC=Bacteria.
Sequence
MKDAAGSTDNSPVRMKSGRHEILGWVLCLLFVFVAAASAQIKIFIDTDLEGVSGVFKFSQ
TREKDTPANIQACEYFMGDLAAVIRGLRDGGATEIIVNDGHGNQAILPHLMEPGAKYVTG
LPRPMGNRWSLDDSCAGLVLFGYHAMNGTPDGVLHHTQSSLAEKKFWYNGVECGELVQTA
AVAGHFGVPPILVTGDEATCREAVRFLGDEIVTVATKRGLAREAAVLYPFAETRKALYEG
AKKAMIALPRCKPFVMKPPIQVKMQYLEKDTELAEPKLKVKEWVAQDALHLLAP
Download sequence
Identical sequences A0A1V5KKM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]