SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V5NZG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V5NZG9
Domain Number 1 Region: 38-119
Classification Level Classification E-value
Superfamily FlaG-like 2.88e-24
Family FlaG-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V5NZG9
Sequence length 121
Comment (tr|A0A1V5NZG9|A0A1V5NZG9_9FIRM) Flagellar protein FlaG {ECO:0000313|EMBL:OQA10422.1} OX=1852891 OS=Firmicutes bacterium ADurb.Bin373. GN=BWY65_00631 OC=Bacteria; Firmicutes.
Sequence
MKVLNTGNNHAPITQDAMVKRESVGKGAAIDNEINIPLEAKPGAKDYSNQKLGIAVEQLN
KTMETYNTELRFTIHEESGQILVKVINTEDDSVVREIPPERVLDFVAHVKKMLGILFDRF
I
Download sequence
Identical sequences A0A1V5NZG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]