SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V6Q207 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V6Q207
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000000000101
Family Preprotein translocase SecE subunit 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V6Q207
Sequence length 70
Comment (tr|A0A1V6Q207|A0A1V6Q207_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OQD83310.1} KW=Complete proteome; Reference proteome OX=416450 OS=Penicillium antarcticum. GN=PENANT_c017G06301 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MSETFQELADIPKDFVREGSQFVRRCTKPDKREFIKISQAVGMGFLVMGAIGYFVKLIHI
PVNQVLVGGA
Download sequence
Identical sequences A0A1F5LM05 A0A1V6Q207 A0A1V6TCM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]