SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V8SVK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V8SVK6
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.22e-37
Family Calponin-homology domain, CH-domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 172-234
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000131
Family EB1 dimerisation domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V8SVK6
Sequence length 253
Comment (tr|A0A1V8SVK6|A0A1V8SVK6_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OQO03176.1} KW=Complete proteome; Reference proteome OX=1507870 OS=Rachicladosporium antarcticum. GN=B0A48_11431 OC=Rachicladosporium.
Sequence
MGESRQELLTWLNGLLQLNMTKVEQCGTGAALCQIYDSIFLDVPMSRVKFNANAEYAYLE
NFKILSSTFRKHHVDRPVAVEQLVKCKMQDNLEFLQWTKRYWDQYFPGGEYDAVGRRKGV
AASLPATGNSRTSGAGTGAGAARRPVGAAAGAGAPRTGSRQAGLGGGQASAALQTKNAEL
MDTVQGLERERDFYFSKLRDIELLIQQAMEADPALEEDEGGLLKQIQTILYSTEGFEIPQ
DAEGEPVGEEETF
Download sequence
Identical sequences A0A1V8SVK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]