SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V8TBS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V8TBS5
Domain Number 1 Region: 26-83
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000157
Family Transducin (heterotrimeric G protein), gamma chain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V8TBS5
Sequence length 92
Comment (tr|A0A1V8TBS5|A0A1V8TBS5_9PEZI) Guanine nucleotide-binding protein subunit gamma {ECO:0000313|EMBL:OQO08701.1} KW=Complete proteome; Reference proteome OX=1507870 OS=Rachicladosporium antarcticum. GN=B0A48_02194 OC=Rachicladosporium.
Sequence
MSAPYEIRTNDNGKSKKQSMAELKLRRLTELNQRLQEDLNRRRIPVSEAAMDLIAFTDKE
PKDFMVPSRWGTIDKREDPYAPQQSNGCCSVM
Download sequence
Identical sequences A0A1V8TBS5 A0A1V8U7C6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]