SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V8UYE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V8UYE0
Domain Number 1 Region: 2-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-72
Family Capz beta-1 subunit 0.000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V8UYE0
Sequence length 278
Comment (tr|A0A1V8UYE0|A0A1V8UYE0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OQO28437.1} KW=Complete proteome; Reference proteome OX=1974281 OS=Rachicladosporium sp. CCFEE 5018. GN=B0A51_02986 OC=Rachicladosporium.
Sequence
MSDPFDAALDLLRRLPPSQTQQNLASIISIAPNLEDDLLSSVDVGLAVKRCPKSGRDYLC
CDYNRDGTSYRSPWSNDFVPPIDPDDAADLVPRGKIRRMEEELNKSIDVYRELYYEGGVS
SAYLWQLDEGFAGVVLVKKSSGGAGKGGWDSINVFEIIEATSKRSAHYKLTSTVILDLGL
KNDAVGGLELAGNLTRQEELDQPLAGLRDAEIESSHVANMGRMVEAMETRLRNLLQEVYF
GKAKDVVGDLRSIRLLSEAEQERRSHKEVISKMGGATI
Download sequence
Identical sequences A0A1V8UYE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]