SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V9Y424 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9Y424
Domain Number 1 Region: 2-219
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-49
Family Capz alpha-1 subunit 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9Y424
Sequence length 221
Comment (tr|A0A1V9Y424|A0A1V9Y424_9STRA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OQR80466.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_12050 OC=Thraustotheca.
Sequence
LQSSPPGELRDVAKDVSKLLPAGLLSDATLNHVMHEYNREHRVSAMTPDGTHRIAISKET
EVDSTHYLDTKSKKIFGFDHINHQLNPNEVQDCPDKFSLPDEPYRLVLQNALDDYSLAQY
ANQGVVAVVSTGESEIAIVISTERINLRNYWSGRWTSKWKLQLEGQAATLSGSIDVHVHY
YEDGNLQLQSRKDVEQTITYHDPSSLASAVVQAISDEEHVI
Download sequence
Identical sequences A0A1V9Y424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]