SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W0X8T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W0X8T0
Domain Number 1 Region: 6-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.72e-102
Family Capz alpha-1 subunit 0.0000000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W0X8T0
Sequence length 290
Comment (tr|A0A1W0X8T0|A0A1W0X8T0_HYPDU) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OQV23927.1} KW=Complete proteome; Reference proteome OX=232323 OS=Hypsibius dujardini (Water bear) (Macrobiotus dujardini). GN=BV898_02275 OC=Hypsibiidae; Hypsibius.
Sequence
MAEAITEDDKVSIVSRFLLHAPPGEFNEVFNDVRTLLSDDTLLKDRLSGSFAQYNKDQFT
PVRVDGAELAVVISEHNDLGRHRFFDPRSKRSFHFDHLRKEAKDVQPQEFDSKAESWRSA
FEAHFSNYVDNYYKHGVCSVFSKYDAGVITIVACIEDHQFQPKNFWNGRWRAQWSLSFSP
GSQSKAELRGIVKVQVHYYEDGNVQLVSSKEISEDITVTSENETAKEVVAIVLEAENQYQ
TGVSENYSTMSETTFKALRRQLPLTRTKIDWGKITGYRIGNEIGGKGDLK
Download sequence
Identical sequences A0A1W0X8T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]