SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W1BX00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W1BX00
Domain Number 1 Region: 1-200
Classification Level Classification E-value
Superfamily YcfC-like 6.41e-40
Family YcfC-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W1BX00
Sequence length 203
Comment (tr|A0A1W1BX00|A0A1W1BX00_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:SFV58033.1} OX=652676 OS=hydrothermal vent metagenome. GN=MNB_SUP05-5-762 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MNQLQHQILSLSASIQASYLINNLATNGVCAIEQRDTLIESLFVTNSINTLDIYQNPKNL
NFGLQQLQNLLKKEKDINKEPIKYSIQTNILAKKITKTPQILQKINTEITNINNNKFFLN
THPNSILKLADLYKATASRLSPTILISGKQEFLSNEEITNQIRMLLLSSIRALILWQSYQ
GRAWKLFFNKNKILETISVLRDN
Download sequence
Identical sequences A0A1W1BX00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]