SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W2B8W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W2B8W9
Domain Number 1 Region: 21-130
Classification Level Classification E-value
Superfamily MtlR-like 5.1e-20
Family MtlR-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W2B8W9
Sequence length 200
Comment (tr|A0A1W2B8W9|A0A1W2B8W9_9PSED) Uncharacterized protein {ECO:0000313|EMBL:SMC69463.1} KW=Complete proteome OX=1261630 OS=Pseudomonas sp. URIL14HWK12:I5. GN=SAMN05660385_02042 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKPADDNPRHGNLEMANAFKLVAESLINETDRGTVVLATAWLDESLTAILRTYMKPSEKA
DDLFSPGRPLGDFGTKIILADRLRLVAPSMIRSLEIIRKLRNEFAHIASDLTFETQSVKD
RVQNVFRENEDLLLVMGETLIEKGMSFGQEDDLSIEHMLKRFGTRALFQYTCAFLNGALA
LVKFHLKPAEPQFSFEELEP
Download sequence
Identical sequences A0A1W2B8W9
WP_084296922.1.42506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]