SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W4V199 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4V199
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-96
Family Capz beta-1 subunit 0.00000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W4V199
Sequence length 276
Comment (tr|A0A1W4V199|A0A1W4V199_DROFC) F-actin-capping protein subunit beta {ECO:0000313|RefSeq:XP_017050105.1} KW=Complete proteome; Reference proteome OX=30025 OS=Drosophila ficusphila (Fruit fly). GN=LOC108094164 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSEMQMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYL
LCDYNRDGDSYRSPWSNSYYPPLEDGQMPSERLRKLEIEANYAFDQYREMYYEGGVSSVY
LWDLDHGFAAVILIKKAGDGSKMIRGCWDSIHVVEVQEKTTGRTAHYKLTSTAMLWLQTN
KQGSGTMNLGGSLTRQQEQDANVSESSPHIANIGKMVEEMENKIRNTLNEIYFGKTKDIV
NGLRSTQSLADQRQQAAMKQDLAAAILRRNVKPESN
Download sequence
Identical sequences A0A0J9QUP7 A0A1W4V199 B3N8W6 B4IDA9 B4P3K4 M9PBN7 P48603
DS10_00000761 7227.FBpp0077549 7245.FBpp0262680 FBpp0077549 FBpp0198304 7296053___KOG3174 FBpp0077549 FBpp0304020 FBpp0262680 NP_001259877.1.81976 NP_477005.1.81976 XP_001968307.1.56816 XP_002041719.1.34323 XP_002087559.1.41174 XP_016023037.1.80810 XP_016923034.1.48971 XP_016982751.1.97277 XP_017009771.1.47939 XP_017050105.1.74164 XP_017075780.1.81094 FBpp0143348 FR96 FBpp0077549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]