SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W4YJM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4YJM7
Domain Number 1 Region: 3-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-96
Family Capz beta-1 subunit 0.000000000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4YJM7
Sequence length 277
Comment (tr|A0A1W4YJM7|A0A1W4YJM7_9TELE) F-actin-capping protein subunit beta isoforms 1 and 2 isoform X1 {ECO:0000313|RefSeq:XP_018588558.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=LOC108922725 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MNDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYEPPIDDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTT
KTGSGTMNLGGSLTRQMEKDETVGESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDSLPDNQTYRQLQKELSQVLTQRQIFIQPDN
Download sequence
Identical sequences A0A1W4YJM7
XP_018588558.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]