SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W4ZA39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4ZA39
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.66e-95
Family Capz beta-1 subunit 0.000000000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4ZA39
Sequence length 272
Comment (tr|A0A1W4ZA39|A0A1W4ZA39_9TELE) F-actin-capping protein subunit beta isoform X2 {ECO:0000313|RefSeq:XP_018597578.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=capzb OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MNDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKIVGKDYL
LCDYNRDGDSYRSPWSNKYEPPLDDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTT
KTGSGTMNLGGSLTRQMEKDETVGESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQSLADRTKQEALKNDLMEALKRKQQS
Download sequence
Identical sequences A0A1W4ZA39
XP_018597578.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]