SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5WH15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5WH15
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 4.45e-96
Family Cytochrome f, large domain 0.0000000137
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.71e-21
Family Cytochrome f, small domain 0.0000531
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 5.62e-16
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5WH15
Sequence length 320
Comment (tr|A0A1W5WH15|A0A1W5WH15_9ASTR) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=381990 OS=Diplostephium ericoides. GN=petA OC=Asteroideae; Astereae; South American lineages; Diplostephium.
Sequence
MQTRNTFSWIKEQITRSISISLMIYIITRTSISNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQVLANGKKGALNVGAVLILPEGFELAP
PDRISPEIKEKMGNLSFQSYRPNQKNILVIGPVPGQKYSEITFPILSPDPATKKDTHFLK
YPIYVGGNRGRGQIYPDGSKSNNTVYNATASGIVSKILRKEKGGYEITIADASDGRQVVD
IIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQ
IFLVLKKKQFEKVQLSEMNF
Download sequence
Identical sequences A0A0H3U0N3 A0A0K0LZR9 A0A0K0M0I4 A0A0K0M336 A0A1S6XV63 A0A1W5W964 A0A1W5WA59 A0A1W5WAD8 A0A1W5WAM5 A0A1W5WBC0 A0A1W5WE22 A0A1W5WEQ6 A0A1W5WFL0 A0A1W5WG30 A0A1W5WG81 A0A1W5WH15 A0A1W5WHH8 A0A1W5WJL2 A0A1W5WK37 A0A1W5WKK4 A0A1W5WMQ9 A0A1W5WMZ7 A0A1W5WNG3 A0A1W5WPF5 A0A1W5WPQ6 A0A1W5WPX0 A0A1W5WRN1 A0A1W5WTT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]