SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W6ZE57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W6ZE57
Domain Number 1 Region: 51-160
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000157
Family Apolipoprotein 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W6ZE57
Sequence length 193
Comment (tr|A0A1W6ZE57|A0A1W6ZE57_9BORD) Uncharacterized protein {ECO:0000313|EMBL:ARP95587.1} KW=Complete proteome; Reference proteome OX=463040 OS=Bordetella genomosp. 13. GN=CAL15_15055 OC=Alcaligenaceae; Bordetella.
Sequence
MNDMVIPFDTLEITERLERGGFTREQARTQAAVLADVVNVDRLGIVTRGNLLDTERALRG
GFDRACNEIRGDFDRTCNEIRGDFDRTCNEIKADIASVRSETKTEIAGVRSEIQSVRSEL
KTEIADVRHELKAEIQGTRSELKADIEGVRSELSVGLANVKGEITRLHWVLGVVVTGLGS
VIYKLFLGSAPLP
Download sequence
Identical sequences A0A1W6ZE57
WP_086079349.1.19019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]