SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0MEQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0MEQ3
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.44e-34
Family Frataxin-like 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X0MEQ3
Sequence length 105
Comment (tr|A0A1X0MEQ3|A0A1X0MEQ3_9BURK) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome OX=1755991 OS=Burkholderia sp. A27. GN=B2G74_31130 OC=Burkholderiaceae; Burkholderia.
Sequence
MSDSEYLTRAEAALAAIERALDDTDADIEFERSGNVLTLEFENRSKIIVNLQPPMSEIWI
AAKAGGFHFRFVDGEWRDTRSGTEFFAALSEYATQQAGEPVHFEA
Download sequence
Identical sequences A0A1M6W8A0 A0A1X0MEQ3
WP_073431841.1.1202 WP_073431841.1.61235 WP_073431841.1.94246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]