SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X1C410 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X1C410
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily YcfC-like 9.68e-81
Family YcfC-like 0.0000000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X1C410
Sequence length 212
Comment (tr|A0A1X1C410|A0A1X1C410_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695} KW=Complete proteome OX=665913 OS=Pantoea calida. GN=HA40_13380 OC=Erwiniaceae; Pantoea.
Sequence
MAKNYYDITLALAGICQAAHLAQQLAHQGQCDAQSLKTSLSSLLDLNPSSTLAVYGNDET
HLRFGLETLLAVLNTPSRQGAGAELTRYTLSLMVLERKLNANKSALNTLAQRIAQLDRQL
THYDIESETIVAAMAGIYVDVISPLGPRIQVTGSPAVLQNSQVQSKIRASLLAGIRSAVL
WQQVGGGRLQLMFFRNRLMSEAKRILAGMPSA
Download sequence
Identical sequences A0A0A1B5J4 A0A1X1C410
WP_038626703.1.24429 WP_038626703.1.7683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]