SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X2I5C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X2I5C7
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000262
Family Transducin (heterotrimeric G protein), gamma chain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X2I5C7
Sequence length 79
Comment (tr|A0A1X2I5C7|A0A1X2I5C7_9FUNG) GGL domain-domain-containing protein {ECO:0000313|EMBL:ORZ09812.1} KW=Complete proteome; Reference proteome OX=90262 OS=Absidia repens. GN=BCR42DRAFT_423111 OC=Cunninghamellaceae; Absidia.
Sequence
MQRRHTREELAELKLRRLLIHNQNLNAQLDVPRLPVSEASRELIDFCSGTHDPLLPSIWG
PVKEDPFTPLKKKWACCNI
Download sequence
Identical sequences A0A1X2I5C7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]