SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X3LJS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X3LJS0
Domain Number 1 Region: 26-104
Classification Level Classification E-value
Superfamily YdhA-like 1.16e-23
Family YdhA-like 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X3LJS0
Sequence length 107
Comment (tr|A0A1X3LJS0|A0A1X3LJS0_ECOLX) Putative lipoprotein {ECO:0000313|EMBL:OSL74614.1} KW=Complete proteome OX=656433 OS=Escherichia coli TA054. GN=EAXG_01146 OC=Enterobacteriaceae; Escherichia.
Sequence
MKKLLLICLPVLLTGCSAFNQLVERMQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLL
HLKQGISASGARYTDGIYVFWSKGEEATVYKRDRIVLNNCQLQNSQR
Download sequence
Identical sequences A0A024KW16 A0A080IW21 A0A1X3LJS0 E2XG39 T9SR96 U9Z355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]