SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X3MHM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1X3MHM3
Domain Number - Region: 26-135
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.012
Family Capz beta-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X3MHM3
Sequence length 146
Comment (tr|A0A1X3MHM3|A0A1X3MHM3_9BACI) Uncharacterized protein {ECO:0000313|EMBL:OSM10153.1} KW=Complete proteome OX=155322 OS=Bacillus toyonensis. GN=BTH38_26335 OC=Bacillus cereus group.
Sequence
MNTINKILSDFAEINADEYVRNYYELSIMSENKKDNIFELAKKATYATSNDTLELIHLKE
WKKEFLICQYPNGESSWFGKIPYGYDLNGLTSKEYIIERLLNVFKQEPDEVYWIKLDPGG
YYACCYEEYLFKTNKGIYFFSMQVHD
Download sequence
Identical sequences A0A1E8ALB4 A0A1X3MHM3 C2V402 C2VKH5
WP_001092363.1.24969 WP_001092363.1.24992 WP_001092363.1.3196 WP_001092363.1.4453 WP_001092363.1.499 WP_001092363.1.52532 WP_001092363.1.64770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]