SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7R328 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7R328
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.07e-36
Family Calponin-homology domain, CH-domain 0.000043
Further Details:      
 
Domain Number 2 Region: 191-261
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000379
Family EB1 dimerisation domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X7R328
Sequence length 329
Comment (tr|A0A1X7R328|A0A1X7R328_9SACH) Similar to Saccharomyces cerevisiae YER016W BIM1 Microtubule-binding protein {ECO:0000313|EMBL:SMN19981.1} KW=Complete proteome; Reference proteome OX=1789683 OS=Kazachstania saulgeensis. GN=KASA_0O06127G OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kazachstania.
Sequence
MSNNIGESRTELLNWLNDLLKLNYKKIEECGTGAAYCQIMDSVYVDVPMHRVKFNATAEY
EFHTNYKILQSCFARHAIEKTVYVERLVKCRFQDNLEFLQWIKKFWMQNKDSSPYDAISR
RKHRQVSGSIGGTAPPSSGSISIAKRKSSMPTQTYGSTRSSYGTSGVTRRISNDQYLAIQ
TELTQAKNNMTAMDKEINTYKDTTNILERERDFYFSKLRDIEILVQSTQDLIKEGVYESG
TGELDKFLNKVQQILYATEDSNEGDQRQNEENRTETINTSDQQYMDKDNLTNHSSISVQN
HEPIMNNLSMNNPPAQAVPQNLIIDDETF
Download sequence
Identical sequences A0A1X7R328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]