SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X7TV61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1X7TV61
Domain Number - Region: 175-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 52-106
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz beta-1 subunit 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X7TV61
Sequence length 358
Comment (tr|A0A1X7TV61|A0A1X7TV61_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.19094_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
MFPFNSDIYVNMKLNTKKIALYRAILGLLFFPCCLSHYVLEIRAVRYQNPTDEDYNGGSC
DTILFPNCDVYFYFCIRNIHLSPSNTHNCWDSITTSSSFEDTDRLFPTTGQLYQGANTQN
PLTFTSHNAWPGSFQLLVSSIDDDINSDDLIDRNAFNLNITPTDSWSSLITTSGHYNKVT
FTIQVQLSCITGWTGNDCEQCIPRAGCSSINGRCTLPGECICDNGYTGSNCTQPIAATTT
SSSITSSTTKYIPSNTNIATPTPFSSAAATIFPSSSTLTPSTNPQSDESNVVTIAGGAAA
CGVVILLIIVLVIIVSYCVIKSKNKEKMKEAQRNEMPEPFNKNLMYMSPEVLDDKYTK
Download sequence
Identical sequences A0A1X7TV61
Aqu1.212487|PACid:15711015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]