SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X9QE56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X9QE56
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 9.94e-50
Family Spike glycoprotein-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X9QE56
Sequence length 254
Comment (tr|A0A1X9QE56|A0A1X9QE56_9RHAB) Glycoprotein {ECO:0000313|EMBL:ARQ21049.1} OX=11292 OS=Rabies lyssavirus. GN= OC=Mononegavirales; Rhabdoviridae; Lyssavirus.
Sequence
CPPDQLVNLHDFHSDEIEHLVVEELVKKREECLDALETIMTTKSVSFRRLSHLRKLVPGF
GKAYTIFNKTLMEADAHYKSIRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHV
LIPEMQSSLLHQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVD
LGLPNWGKYVLISAGALTALMLTIFLMTCCRKTNRAGSIQHSPGETGRKVSVTSHNGRVI
SSWESYKSGSETKL
Download sequence
Identical sequences A0A1X9QE56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]