SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1TSQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1TSQ3
Domain Number 1 Region: 31-120
Classification Level Classification E-value
Superfamily FlaG-like 4.05e-24
Family FlaG-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1TSQ3
Sequence length 121
Comment (tr|A0A1Y1TSQ3|A0A1Y1TSQ3_PSECL) Flagellar biosynthesis protein FlaG {ECO:0000313|EMBL:ORM50375.1} KW=Complete proteome OX=333 OS=Pseudomonas chlororaphis (Pseudomonas aureofaciens). GN=B6D51_03780 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDMSMKLNLSYPTAKPATPVADKPVEKPQADVVALSTVKEESKSAQTEQDKLKMAIKEIE
EFVQSVKRNLEFSIDEPSGKVVVKVIASDSGEVIRQIPNEEVLKLANSLNDASSLLFSAK
V
Download sequence
Identical sequences A0A1Y1TSQ3
WP_053260596.1.29320 WP_053260596.1.34267 WP_053260596.1.47602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]