SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Y1WHE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1WHE0
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-73
Family Capz alpha-1 subunit 0.00000298
Further Details:      
 
Domain Number 2 Region: 264-394
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-29
Family DNA gyrase/MutL, N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 698-866
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 4.18e-22
Family DNA mismatch repair protein MutL 0.022
Further Details:      
 
Domain Number 4 Region: 409-532
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-22
Family DNA gyrase/MutL, second domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1WHE0
Sequence length 871
Comment (tr|A0A1Y1WHE0|A0A1Y1WHE0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORX72939.1} KW=Complete proteome; Reference proteome OX=61395 OS=Linderina pennispora. GN=DL89DRAFT_290733 OC=Kickxellaceae; Linderina.
Sequence
MSIVEKAAKLLLHSPPGEVDDVFNDIRGIVNDDEALQEHIEPVLAESNMQHFLVVEVPET
ESKVLLTPYNKLEDGRYLCPNTQQEFAFDHVRRVAHDAQEAAAAGANEEQRAQLQTALDA
YVLAHYPEGAGTVFSHEGQLVLCIVSNRFSPGNFWNGSWRAVWSFSAETGQLNGSAKVTV
HYFEDGNVQLDTQAEFTADLEGDFQRGINDGFRQLAEKTFRGLRRTLPVTRNKVDWEKIA
NYRIGSELTMAGGSGEMLPIGKDTAVKELLENSLDSGATSVEIRLKDNGLTSITVIDNGS
GIASAAHATVCRKHWTSKIRSFTDLSTITTFGFRGEALSSLCAVATLTYDMAGALASSSP
VARSHGTTQELQRHARREYLKLVGLVEQYAIISNARLVLSNQTKGSASVAVRTAAQSSLL
GRLSAVFGRSKGLDVTVGGHVSRALPEAGRSASDKQYFFVNGRPCEFMRAKRLVNELFRG
KCPARYPVFAIMVGVNQDTVDVNLTPDKRTILLRHEDVVLRALREAVGEALEPKESEFAV
HKKVQVLLGGAGTKRPAEQMDIRSSDDFEAPPLKTRVSPSVVMVTKPAQPPALVHAPSSI
PLESSSLLATPTASAPPAVPKRQPAKKPATMVIGACRNRLRDISYDWSKVSARMQQRQQS
ASIPEPPSTPETASGVHLSDAEARASLSRLIRKSDFAQMQVLGQFNLGFIIARFRDDLFI
IDQHASDEKYNFETLQSTARIASQPLIRPHVLELNIVDEAVAMQNLHVLERNGFGLSVDE
QAVPGRRLSMVSQPVIDQTMFSEADLRELIARLSADPQPRCERASPHSVMIGDPLSSAQM
RRIVANLSGLDHPWNCPHGRPVMRHLFHLPQ
Download sequence
Identical sequences A0A1Y1WHE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]