SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Y2AZ19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2AZ19
Domain Number 1 Region: 1-259
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.29e-72
Family Capz beta-1 subunit 0.000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2AZ19
Sequence length 262
Comment (tr|A0A1Y2AZ19|A0A1Y2AZ19_9FUNG) F-actin-capping protein subunit beta-like protein {ECO:0000313|EMBL:ORY27540.1} KW=Complete proteome; Reference proteome OX=1754190 OS=Neocallimastix californiae. GN=LY90DRAFT_524197 OC=Neocallimastigales; Neocallimastigaceae; Neocallimastix.
Sequence
MDLMRRLPPQNIEINVANLIDLCQDDEEDFDDFTGDLLSSIHQPLIVKVCPETNREYLAS
DYNRDLDSYRSPWSNNFDPPLQDATYPSDQLRKLEVQANEAFDVYRDLYYGGGLSSVYMW
DTENGFAAAVFLKKTNEKNATDKSSWDSIHIFEVENKGRNVLYKLTSTITLYIVSSNKDM
GNMNLSGSLTRYTESEFSNQEHIGNLGRMVEGMEFNMRNTLQEIYFGKTRNIVNELRSIA
SLQDEKKKMLFTKDLMNRLKKN
Download sequence
Identical sequences A0A1Y2AZ19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]