SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2FTT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2FTT7
Domain Number 1 Region: 15-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.28e-38
Family PDI-like 0.0068
Further Details:      
 
Domain Number 2 Region: 136-238
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.03e-18
Family ERP29 C domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2FTT7
Sequence length 249
Comment (tr|A0A1Y2FTT7|A0A1Y2FTT7_9ASCO) Thioredoxin-like protein {ECO:0000313|EMBL:ORY86105.1} KW=Complete proteome; Reference proteome OX=56484 OS=Protomyces lactucaedebilis. GN=BCR37DRAFT_376649 OC=Taphrinomycetes; Taphrinales; Protomycetaceae; Protomyces.
Sequence
MKFSLITLLTVVQAAVVELTDENFDEVVLDPTKNVLVKYFAPWCGHCKSLAPIFEKVAED
YEQDDDIVIAKIDCDKYKTIGTRFGIQGFPTLKYFPAGDKTPVEYNSGRTEEAFLEFINE
KTGSFRLPGGALNALAGRVPSLDSIAQKIGATKGESLTALLAEGRAALDDYAKEAKNDIY
KYYYRVLEKLETKPDWIDTEYARLSKLLQNSSALAKEKLNELRQKKNILEAFLGREAKKL
VGKTDKEEL
Download sequence
Identical sequences A0A1Y2FTT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]