SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2FY94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2FY94
Domain Number 1 Region: 6-139
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 4.58e-37
Family Eukaryotic RPB5 N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 136-210
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 4.58e-29
Family RPB5 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2FY94
Sequence length 211
Comment (tr|A0A1Y2FY94|A0A1Y2FY94_9BASI) RPB5 subunit of DNA-directed RNA polymerase {ECO:0000313|EMBL:ORY89001.1} KW=Complete proteome; Reference proteome OX=106004 OS=Leucosporidium creatinivorum. GN=BCR35DRAFT_276078 OC=Microbotryomycetes; Leucosporidiales; Leucosporidium.
Sequence
MADDAERETARLFRVSRTIHELVRDRGYEIAANEISMDLNEFKNLYAKGSTSIDKNHIAF
KARMQAERGEGEIYVFYADEASVGIKTMRKFITILEDQKIGRGIIIYKTNMTPSANKVIS
AMASQFQIEAFQESELLVNITQHILVPQHEVLTMEEKRELLTKYRLKDTQLPRIQLQDPV
SRYYGLKRGQVVKITRPSETSGRYVSYRLCL
Download sequence
Identical sequences A0A1Y2FY94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]