SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HD09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HD09
Domain Number 1 Region: 196-252
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.62e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00068
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000314
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HD09
Sequence length 252
Comment (tr|A0A1Y2HD09|A0A1Y2HD09_9FUNG) Transcription factor IIA, alpha/beta subunit {ECO:0000313|EMBL:ORZ32478.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_1515444 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MSNSVIPNLYRDIINKVIEDARVDFESYNIDESILDELRITWEKKLFESRVADFSFIEED
EYYGEPAAAAAPAAPAPAPVPAAPVAAAGAAAANPQMPPMFQFNAPVMGSFAPEGRPRPP
PASTQPNASDAVPQYDGPADDVESASSSAVSTSASLSTPAVASSHVVSPMIQQVDGADDD
PDDDPDAINSDLDDDDEDADDEADAEAQNQILCLYEKVNRTKNKWKCTMREGIIHVNGKD
YAFSRLTGDYQF
Download sequence
Identical sequences A0A1Y2HD09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]