SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Y2W0J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2W0J8
Domain Number 1 Region: 55-321
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.89e-81
Family Capz beta-1 subunit 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2W0J8
Sequence length 322
Comment (tr|A0A1Y2W0J8|A0A1Y2W0J8_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OTB02296.1} OX=1001833 OS=Hypoxylon sp. CI-4A. GN=M426DRAFT_197910 OC=Hypoxylon.
Sequence
MFPLQHLKRLSISNTPNTLIGCIDRLWHLYIENTQDDTLPAAQPSQPVTTMASVDPFDSA
LDLLRRLNPKYTSSHLNSLIQLAPDLTEDLLSSVDQPLSIRRCQQTGRDYLLCDYNRDGD
SYRSPWSNEFDPPLDSGAAASASLPSEKVRKMEVRANEAFDVYRDLYYEGGVSSVYFWNL
DDGFAGVVLLKKEAKPGSASEGTWDSIHVFEAIDRARFTQYNLTSTVILSLSTNSNSLGD
MDLSGNMTRQIELELPAESDEQQIANIGKLVEDMELKMRNLLQEVYFGKAKDVVGDLRSV
GSLSEGARDREAQKELIGSMMK
Download sequence
Identical sequences A0A1Y2W0J8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]