SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2WVK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2WVK0
Domain Number 1 Region: 95-164
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 6.41e-29
Family Cyanase C-terminal domain 0.0004
Further Details:      
 
Domain Number 2 Region: 17-90
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000751
Family SinR domain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2WVK0
Sequence length 164
Comment (tr|A0A1Y2WVK0|A0A1Y2WVK0_9PEZI) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_03139} OX=1001832 OS=Daldinia sp. EC12. GN=K445DRAFT_319934 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Hypoxylaceae; Daldinia.
Sequence
MSDHPRITVLDETLAGNLPSVSKTLFQAKARHGYTFEELAQKLGRSEVAVAALFYGQAQA
SDADIEKLTEVLGLPKGELHELSLGFPNRGRAGPMPPVEPLIYRLYEVVQNYGYAFKAVI
NEKFGDGIMSAIAFSSKVEKEVDNDGVTWVNITLRGKWLPFTRF
Download sequence
Identical sequences A0A1Y2WVK0
jgi|DalEC12_1|319934|fgenesh1_kg.21_#_165_#_Locus1559v1rpkm90.45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]