SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3AFF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3AFF9
Domain Number 1 Region: 9-53
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000392
Family Preprotein translocase SecE subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3AFF9
Sequence length 58
Comment (tr|A0A1Y3AFF9|A0A1Y3AFF9_9EURY) Protein transport protein Sec61 gamma subunit homolog {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome OX=1855863 OS=Halorubrum sp. SD612. GN=B9G38_11680 OC=Halorubrum.
Sequence
MDVPYDPNSYIRVLKLASTPSTDEFLQVSKIAGAGILLIGFIGFLMFAIMSLLPGVGA
Download sequence
Identical sequences A0A1Y3AFF9
WP_086220482.1.88288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]