SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3DJ88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y3DJ88
Domain Number - Region: 169-231
Classification Level Classification E-value
Superfamily IpaD-like 0.00497
Family IpaD-like 0.011
Further Details:      
 
Domain Number - Region: 129-170
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0589
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3DJ88
Sequence length 267
Comment (tr|A0A1Y3DJ88|A0A1Y3DJ88_PLAKN) Uncharacterized protein {ECO:0000313|EMBL:OTN64973.1} KW=Complete proteome OX=5850 OS=Plasmodium knowlesi. GN=PKNOH_S120164700 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MKKFKILSSPRVVFCFFSIMNFVLLNRGIKQNAKFLSSQLDVRASPRQLSQFTANSNVYG
DPSELNFYLHDNECSFELGNEYMHDGTSGHVENVKSEKEDEVGGIEDLGKVQDGQEEKSK
QGEQCDEEDLMDHEGRIDIASISKKHAFVMPKDEVELLLVECIEIQISDYQIAMDNLLRE
LHELASKYGMSEEKKMKLWNECQEKISNDFKEVDDYYYEIYSFNMHADTVATAPFLSSLK
TFLNLWKNCIHKTERKWSSFFKVRAQE
Download sequence
Identical sequences A0A1A7VFJ5 A0A1Y3DJ88 B3L5T2
XP_002259480.1.91479 PKH_094522 5850.PKH_094522 gi|193809551|emb|CAQ40253.1| gi|221056684|ref|XP_002259480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]