SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y6KSV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y6KSV5
Domain Number - Region: 102-161
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0458
Family MukF C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y6KSV5
Sequence length 198
Comment (tr|A0A1Y6KSV5|A0A1Y6KSV5_9BRAD) Uncharacterized protein {ECO:0000313|EMBL:SMX61807.1} KW=Complete proteome OX=115808 OS=Bradyrhizobium sp. ORS 285. GN=BRAD285_7189 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MSAQSSMSVYLNWAKERLHEMDAALDALDIKAAEAEAASKVKTAEIMADLKKRRSDLETL
LKTQAAAGDAALAQAKTELDQHWAGFEAQMKTYFDTAGQQAVQQQAIFKDIAAAQAKAWH
EAADRFREAASAGGANVETVLDQLKSDATQAGAHLDKLKQAGSESWSVLSAALSESRKAF
DQANQAAWNALKGSGPKS
Download sequence
Identical sequences A0A1Y6KSV5
WP_006615101.1.48668 WP_006615101.1.54647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]