SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z2LC37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z2LC37
Domain Number 1 Region: 106-243
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.66e-30
Family Leishmanolysin 0.012
Further Details:      
 
Domain Number 2 Region: 27-143
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000102
Family Matrix metalloproteases, catalytic domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z2LC37
Sequence length 286
Comment (tr|A0A1Z2LC37|A0A1Z2LC37_9ACTN) Peptidase {ECO:0000313|EMBL:ARZ71771.1} KW=Complete proteome; Reference proteome OX=1940 OS=Streptomyces albireticuli. GN=SMD11_6195 OC=Streptomyces.
Sequence
MAEYETYCARADEGRARSLASSTSPYTIEVEFLGGLNQAQKAAFTTAADRWVKVIVGDLP
DVNVNGRIIDDLLIQAEGSAIDGPGVILGQAGPGFLRPPGGPGEFLPATGIMSFDKDDLA
SMQANGTLVDVITHEMGHVIGLITSPARKKGLVKGIGGDNPIFRGQQAQEEYRRLRDADE
LKPVPVENEGEPGTRDAHWREKVFANELMTGFVKQAPNPLSRLSVGALQDLGYVVDLEAA
DDYSMPSLLALAEEGELRTHIAPIDVGIVLPTIPTVLPSDSLVTAA
Download sequence
Identical sequences A0A1Z2LC37
WP_087929511.1.38608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]