SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z2XFG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z2XFG8
Domain Number 1 Region: 23-205
Classification Level Classification E-value
Superfamily PG1388-like 1.83e-31
Family PG1388-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z2XFG8
Sequence length 208
Comment (tr|A0A1Z2XFG8|A0A1Z2XFG8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:ASB37160.1} KW=Complete proteome OX=1796646 OS=Muribaculum intestinale. GN=ADH68_03645 OC=Muribaculum.
Sequence
MRRLIIFIAAMASFAMAYPQLTATEAFSSAPASVLPLIDYITRLDMIDYYNSGSATASKN
VMQGQSRITALSPMSVSVSVTSGSECQIALLPMRGDTAIVCIETVMTPTPDSRVSVYDRD
WKPLSGSSFAMPAVSAWLTPEGKKQADVVESQVPFMLASAQYSPETDTLVLTNRLSDFLS
DDVYGLVKPYLLPSITYKWNSSRFVPVK
Download sequence
Identical sequences A0A1B1S6D9 A0A1Z2XFG8
WP_068959760.1.26748 WP_068959760.1.80960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]