SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z3XUQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z3XUQ8
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 6.8e-22
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z3XUQ8
Sequence length 216
Comment (tr|A0A1Z3XUQ8|A0A1Z3XUQ8_CITKO) Sigma-E factor negative regulatory protein {ECO:0000256|PIRNR:PIRNR016938} KW=Complete proteome OX=545 OS=Citrobacter koseri (Citrobacter diversus). GN=CEP66_13610 OC=Enterobacteriaceae; Citrobacter.
Sequence
MQKEKLSALMDGETLDSELLKELAHDPGMQKTWESYHLIRDSMRGDTADVLHFDISARVM
AAIENEPVRQTAPLIPEAQPAPHQWQKMPFWQKMRPWAAQLTQMGVAACVSLAVIVGVQH
YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSDATANGGQQQQVQEQRRRINAMLQDY
ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ
Download sequence
Identical sequences A0A1F2KBB5 A0A1Z3XUQ8
WP_058667974.1.29396 WP_058667974.1.62044 WP_058667974.1.67650 WP_058667974.1.8528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]