SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4IBL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4IBL7
Domain Number 1 Region: 79-146
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.7e-30
Family Cyanase C-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000105
Family Cyanase N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4IBL7
Sequence length 146
Comment (tr|A0A1Z4IBL7|A0A1Z4IBL7_9NOSO) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome OX=1973475 OS=Nostoc sp. NIES-2111. GN=NIES2111_37910 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSIPEITQTLLNAKKNKGLSFGDLEKILGRDEVWIASVFYRQASASPEEAKLLVEALGLD
SLYIQQLTEYPVKGLGPIVPTDPLIYRFYEIMQVYGFPLKEIIQEKFGDGIMSAIDFTLD
VDKETDPKGDRVKITMSGKFLSYKKW
Download sequence
Identical sequences A0A0S3PAW1 A0A1Z4IBL7
WP_067767339.1.33109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]