SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Z5JKR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5JKR9
Domain Number 1 Region: 2-251
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.76e-22
Family Capz beta-1 subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5JKR9
Sequence length 298
Comment (tr|A0A1Z5JKR9|A0A1Z5JKR9_FISSO) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:GAX14615.1} KW=Complete proteome; Reference proteome OX=1519565 OS=Fistulifera solaris (Oleaginous diatom). GN=FisN_6Lh398 OC=Bacillariophycidae; Naviculales; Naviculaceae; Fistulifera.
Sequence
MEAVQSILQKSPPADLETNLEKIRTNVLKDNTDALDSLSKKYLIPLQVCRSDDPGERPFL
KCRYNQKDGKHRSPWTNALHPKTDEPEERDDFRLFELSFNEVWDAYKNLYYGHEAVGSVF
LRDTSDQKGLGPFSGMFGIYKKKSGCGTWNSVSIVHVDNVGKDDTFDFRSYKVETSVWLV
LDDATLQDGEEINTKEQATDSLKVDLSATLSKEVTKELKILPNMLFASHVENIGELIEAN
EMDLRSQLERVSIPKLVEMMDMLMKEKETSFRPPVNPLMGMIMGSDILKKKLEKQGSN
Download sequence
Identical sequences A0A1Z5JKR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]