SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A200QI78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A200QI78
Domain Number 1 Region: 73-148
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.89e-30
Family Skp1 dimerisation domain-like 0.0000341
Further Details:      
 
Domain Number 2 Region: 7-67
Classification Level Classification E-value
Superfamily POZ domain 1.51e-20
Family BTB/POZ domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A200QI78
Sequence length 150
Comment (tr|A0A200QI78|A0A200QI78_9MAGN) SKP1 component {ECO:0000313|EMBL:OVA10213.1} KW=Complete proteome; Reference proteome OX=56857 OS=Macleaya cordata. GN=BVC80_1595g16 OC=Papaveraceae; Papaveroideae; Macleaya.
Sequence
MSTLKKIITLMSSDKETFQVDEAVALESQTIKQMMEDLCADDSIPLPNVTSKILAKVIEY
CKKHIESKEDEDLKAWDAEFVKVDQRTLFEIILAANYLNIKNLLDLTCQAVADGIKDKTP
EEIRKTFNIKNDFTKEEEEAVRRENQWAFE
Download sequence
Identical sequences A0A200QI78

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]