SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A200QSW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A200QSW2
Domain Number 1 Region: 16-178
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 6.67e-57
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 187-357
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.99e-28
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A200QSW2
Sequence length 368
Comment (tr|A0A200QSW2|A0A200QSW2_9MAGN) Histidine kinase-like ATPase {ECO:0000313|EMBL:OVA13529.1} KW=Complete proteome; Reference proteome OX=56857 OS=Macleaya cordata. GN=BVC80_379g60 OC=Papaveraceae; Papaveroideae; Macleaya.
Sequence
MAAKKLSETFSKALIDEVQKWGLMKQTGVSLRYMMEFGSKPTDRYLLISSQFLHKELPIR
IARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPEIKDTNDELAFTQMIKMIKVR
HNNVVPMMALGVQQLKKDLSPKIMQPVDEIHQFLDRFYMSRIGIRMLIGQHVALHDPNPP
PDCVGYIHTKMSPMEVARNASEDARSICLREYGSAPNIDIYGDPNFTFPYVPTHLHLMVF
ELVKNSLRAVQERFMDSDKVAPPIRIIVADGLEDVTIKISDEGGGIPRSGLPKIFTYLYS
TAKNPLDEYSDLGSPDGVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRL
GDSQEPLP
Download sequence
Identical sequences A0A200QSW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]