SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A202G6W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A202G6W6
Domain Number 1 Region: 4-283
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.06e-68
Family Capz beta-1 subunit 0.000000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A202G6W6
Sequence length 288
Comment (tr|A0A202G6W6|A0A202G6W6_CLALS) Putative F-actin-capping protein subunit {ECO:0000313|EMBL:OVF08450.1} KW=Complete proteome OX=36911 OS=Clavispora lusitaniae (Candida lusitaniae). GN=A9F13_08g01507 OC=Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora.
Sequence
MSAEDKFDASLELLRRLDPKAVSDNVGAICTLLRSENEELASDLLSSVDTPLTVAKCGDT
NKSFLCCDYNRDGDSYRSPFSNKYYPPTGDDESPYPTASLRQLEVKANESFDIYRDLYYE
GGGLSSVYMWDTAEDESADSLEEGFAGVVLFKKETDDHSGKWDSIHVFEIVPESASMASY
KLTSSVILDLQNKSAGSKSLSLSGTLTRQIETTQQLSIEGGNLELAHLVNLGQLVEKAEY
NIRNLLQEVYFDKLKNIMLRDLRSVGDISEKEADDSKHSEMIKGLQGL
Download sequence
Identical sequences A0A202G6W6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]