SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212CP12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212CP12
Domain Number 1 Region: 16-45
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.000000111
Family Interleukin 8-like chemokines 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A212CP12
Sequence length 75
Comment (tr|A0A212CP12|A0A212CP12_CEREH) CXCL12 {ECO:0000313|EMBL:OWK07776.1} OX=46360 OS=Cervus elaphus hippelaphus (European red deer). GN=Celaphus_00008414 OC=Pecora; Cervidae; Cervinae; Cervus.
Sequence
MDAKVFVVLALVLTALARLKNNNRQVCIDPKLKWIQEYLDKALNKGSREEKVGKKEKIGK
KKRQKKRKAAQKRKN
Download sequence
Identical sequences A0A212CP12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]