SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212CTX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212CTX6
Domain Number 1 Region: 106-241
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 9.94e-29
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0077
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000069
Family G proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A212CTX6
Sequence length 343
Comment (tr|A0A212CTX6|A0A212CTX6_CEREH) ATL1 {ECO:0000313|EMBL:OWK09459.1} OX=46360 OS=Cervus elaphus hippelaphus (European red deer). GN=Celaphus_00006294 OC=Pecora; Cervidae; Cervinae; Cervus.
Sequence
SLIFLVRDWSFPYEFSYGSDGGSKFLEKRLKVSGNQHEELQNVRKHIHSCFTKISCFLLP
HPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFK
AYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTK
HLELKEESVKLFRGVKKMGGEEFSRRYLQQLETEIDELYIQYIKHNDSKNIFHAARTPAT
LFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQV
AAALWDQALYKLYSAAATHRHLYHQAFPAPKSESTEQSEKKKM
Download sequence
Identical sequences A0A212CTX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]