SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A212FGP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A212FGP2
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.03e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A212FGP2
Sequence length 72
Comment (tr|A0A212FGP2|A0A212FGP2_DANPL) Guanine nucleotide-binding protein subunit gamma {ECO:0000256|RuleBase:RU004973} KW=Complete proteome; Reference proteome OX=278856 OS=Danaus plexippus plexippus. GN=KGM_215044 OC=Danaus.
Sequence
MDASILATMDKEALKKQIENMKYQASMERWPLSKSIAVMREYVEENEKNDPLIHAPDKKN
NPWAEKGKCIIM
Download sequence
Identical sequences A0A212FGP2
DPGLEAN06280-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]