SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A218UPC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A218UPC6
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.75e-39
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 169-276
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000816
Family Netrin-like domain (NTR/C345C module) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A218UPC6
Sequence length 292
Comment (tr|A0A218UPC6|A0A218UPC6_9PASE) Secreted frizzled-related protein 2 {ECO:0000313|EMBL:OWK55647.1} KW=Complete proteome; Reference proteome OX=299123 OS=Lonchura striata domestica (Bengalese finch). GN=RLOC_00005608 OC=Estrildidae; Estrildinae; Lonchura.
Sequence
MQRRLCALLLLASQCMGSAAGLFPFGEPDFSYKRSNCKPIPAPMLLCRGIEYQSMRLPNL
LGHETVQEVLEQASTWIPLVQKQCHPDTRKFLCSLFAPVCIDDLDEIIQPCHSLCEEVKE
SCAPVMSAFGFPWPDMLDCSRFPKDNDLCIPLASSDHILPVTREAPKVCDACKNKNEDDN
DIVENLCKNDFALKIKVKEIAYINGDTKITPETKSKTIYKLNGLTERDLRKIVLWLKGGL
QCTCDEMNDINVPYLVMGQKQAGELVITSLKRWQKGQRAFKRFSRSIRKLQC
Download sequence
Identical sequences A0A218UPC6
XP_009099459.1.15306 XP_021385890.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]