SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A220NBC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A220NBC8
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 2.49e-97
Family Cytochrome f, large domain 0.00000000921
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.7e-19
Family Cytochrome f, small domain 0.000031
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000288
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A220NBC8
Sequence length 320
Comment (tr|A0A220NBC8|A0A220NBC8_9BRAS) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=345537 OS=Euclidium syriacum. GN=petA OC=Euclidium.
Sequence
MQTRNTFSWIREEITRSISVSLMIYIITWASISSAYPIFAQQNYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAP
PDRISPEMKEKIGNLSFQNYRPNNKNILVIGPVPGQKYSEITFPILAPDPATNKDVHFLK
YPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRKEKGGYEITIVDASNGRQVID
IIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQ
IFLVLKKKQFEKVQLSEMNF
Download sequence
Identical sequences A0A220NA81 A0A220NBC8 A0A220NBE2 A0A220NBT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]